PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G25300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 243aa    MW: 26999.1 Da    PI: 8.9451
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G25300.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv +++ +G g+W++ ++  g+ R++k+c++rw +yl
  ORUFI08G25300.1 14 KGAWTKEEDERLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding57.14.1e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++Ed+l+++++ +lG++ W++Ia++++ gRt++++k++w+++
  ORUFI08G25300.1  67 RGNFTADEDDLIIKLHSLLGNK-WSLIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.507961IPR017930Myb domain
SMARTSM007171.4E-131363IPR001005SANT/Myb domain
SuperFamilySSF466891.68E-2913108IPR009057Homeodomain-like
PfamPF002492.9E-151461IPR001005SANT/Myb domain
CDDcd001677.62E-111661No hitNo description
PROSITE profilePS5129428.30862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2765116IPR009057Homeodomain-like
SMARTSM007172.7E-1766114IPR001005SANT/Myb domain
PfamPF002491.1E-1667111IPR001005SANT/Myb domain
CDDcd001671.02E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MGRSPCCEKE HTNKGAWTKE EDERLVAYIR AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TADEDDLIIK LHSLLGNKWS LIAARLPGRT DNEIKNYWNT HIRRKLLGRG  120
IDPVTHRPVN AAAATISFHP QPPPTTKEEQ LILSKPPKCP DLNLDLCISP PSCQEEDDDY  180
EAKPAMIVRA PELQRRRGGL CFGCSLGLQK ECKCSGGGAG AGAGNNFLGL RAGMLDFRSL  240
PMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-291311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0039120.0AP003912.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OJ1479_B11.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650911.11e-180PREDICTED: myb-related protein Zm38
SwissprotP200251e-120MYB38_MAIZE; Myb-related protein Zm38
TrEMBLA0A0E0QM331e-180A0A0E0QM33_ORYRU; Uncharacterized protein
TrEMBLQ6ZJJ21e-180Q6ZJJ2_ORYSJ; Os08g0549000 protein
STRINGLOC_Os08g43550.11e-180(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.17e-92myb domain protein 4